PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G030000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 183aa    MW: 19587.7 Da    PI: 6.354
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G030000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB171.96.8e-5438133297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p++ yl k+re
  Brast01G030000.1.p  38 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFSALGFDDYVDPMRRYLLKFRE 128
                         89***************************************************************************************** PP

               NF-YB  93 legek 97 
                         leg++
  Brast01G030000.1.p 129 LEGDR 133
                         ***97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-5031139IPR009072Histone-fold
SuperFamilySSF471131.45E-3740137IPR009072Histone-fold
PfamPF008085.7E-2743106IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.5E-177189No hitNo description
PROSITE patternPS0068507490IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.5E-1790108No hitNo description
PRINTSPR006154.5E-17109127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MADYHGHGGS GSPDQQRRLL EAGGGGSGEQ QHQDQGIKEQ DRLLPIANVG RIMKQILPPN  60
AKISKEAKET MQECVSEFIS FVTGEASDKC HKEKRKTVNG DDVCWAFSAL GFDDYVDPMR  120
RYLLKFRELE GDRAASSRGA SAGFQAGAAA SSSSAAAAAA AGHFMFDAMD RPDNNNSGSR  180
QF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4237128192Transcription factor HapC (Eurofung)
4g92_B1e-4237128192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-135HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567445.14e-95PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotO822482e-57NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A0Q3KJU13e-96A0A0Q3KJU1_BRADI; Uncharacterized protein
STRINGBRADI2G60050.11e-94(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29173887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.18e-58nuclear factor Y, subunit B5